PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001860m
Common NameCARUB_v10001860mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 237aa    MW: 26328.4 Da    PI: 8.3684
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001860mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++ +G g+W++ ++  g+ R++k+c++rw +yl
  Carubv10001860m 14 KGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.94.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T +Ed+ +++++ +lG++ W++Ia +++ gRt++++k++w+++
  Carubv10001860m  67 RGNFTDDEDQVIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.925961IPR017930Myb domain
SuperFamilySSF466896.13E-2913108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002492.6E-161461IPR001005SANT/Myb domain
CDDcd001671.74E-111661No hitNo description
PROSITE profilePS5129427.81662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2765116IPR009057Homeodomain-like
SMARTSM007178.1E-1666114IPR001005SANT/Myb domain
PfamPF002493.7E-1567111IPR001005SANT/Myb domain
CDDcd001678.06E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIDYIR NHGEGCWRSL PKSAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TDDEDQVIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSHG  120
IDPQTHRPIN DTKTTPSQIV IVDPVQNDAV EYSFSNLAVK PENSSDNGAS TSGTTTDEDL  180
RQNGECYYSD NSGRIEINLD LTLGFGSGSG RVVGAGSSAD SKPWRDQVMA ARLSLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30141167108B-MYB
1h8a_C3e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU269360.0U26936.1 Arabidopsis thaliana clone myb6 DNA-binding protein mRNA, complete cds.
GenBankAY0868130.0AY086813.1 Arabidopsis thaliana clone 28019 mRNA, complete sequence.
GenBankAY5196040.0AY519604.1 Arabidopsis thaliana MYB transcription factor (At4g09460) mRNA, complete cds.
GenBankBT0041710.0BT004171.1 Arabidopsis thaliana clone RAFL15-40-D03 (R20880) putative myb family transcription factor (At4g09460) mRNA, complete cds.
GenBankBT0050850.0BT005085.1 Arabidopsis thaliana clone U20880 putative myb family transcription factor (At4g09460) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288570.11e-176hypothetical protein CARUB_v10001860mg
SwissprotQ388511e-160MYB6_ARATH; Transcription repressor MYB6
TrEMBLR0HCS41e-176R0HCS4_9BRAS; Uncharacterized protein
STRINGAT4G09460.11e-158(Arabidopsis thaliana)
STRINGfgenesh2_kg.6__2929__AT4G09460.11e-158(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.11e-149myb domain protein 6